PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g085440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 124aa    MW: 14273.4 Da    PI: 11.0197
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g085440.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B365.86.4e-212573893
                    EEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3 38 ledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93
                    + + +g++W+++++y+++s++yvltkGW++Fvk+++L++gD+v+F+++   +++l+
  Csa05g085440.1  2 VSNVNGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLRAGDVVTFQRSTGLDRQLY 57
                    67889*****************************************7655555455 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.394166IPR003340B3 DNA binding domain
PfamPF023626.1E-18260IPR003340B3 DNA binding domain
SuperFamilySSF1019367.85E-18358IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.6E-22464IPR015300DNA-binding pseudobarrel domain
CDDcd100173.26E-15449No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MVSNVNGKVW RFRYSYWNSS QSYVLTKGWS RFVKEKNLRA GDVVTFQRST GLDRQLYIDW  60
KIRSGPRENP VQVVVRLFGV DIFNVNTVKP NDVVAVCGRK RSRDADDMFG LRCSRKQAII  120
NPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A3e-3346558119DNA-binding protein RAV1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0138871e-142AB013887.1 Arabidopsis thaliana mRNA for RAV2, complete cds.
GenBankAC0116651e-142AC011665.8 Arabidopsis thaliana chromosome 1 BAC T6L1 genomic sequence, complete sequence.
GenBankAC0119141e-142AC011914.9 Arabidopsis thaliana chromosome 1 BAC F14K14 genomic sequence, complete sequence.
GenBankAF0031011e-142AF003101.1 Arabidopsis thaliana AP2 domain containing protein RAP2.8 mRNA, partial cds.
GenBankAF3603121e-142AF360312.1 Arabidopsis thaliana putative DNA-binding protein(RAV2 (At1g68840) mRNA, complete cds.
GenBankAY0563611e-142AY056361.1 Arabidopsis thaliana putative DNA-binding protein RAV2 (At1g68840) mRNA, complete cds.
GenBankCP0026841e-142CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010415512.14e-78PREDICTED: AP2/ERF and B3 domain-containing transcription repressor RAV2
SwissprotP822801e-77RAV2_ARATH; AP2/ERF and B3 domain-containing transcription repressor RAV2
TrEMBLR0IF207e-77R0IF20_9BRAS; Uncharacterized protein
STRINGAT1G68840.13e-75(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84827121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68840.26e-79related to ABI3/VP1 2